PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00278.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 84aa    MW: 9458.77 Da    PI: 4.3441
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00278.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM66.29.3e-21654150
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
                             lppGfrFhPtdeelv +yL +kv+g+++el e+i+evd+yk+ePwdLp +
  Rsa1.0_00278.1_g00003.1  6 LPPGFRFHPTDEELVAYYLDRKVNGRTIEL-EIIPEVDLYKCEPWDLPGR 54
                             79****************************.99**************953 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-21355IPR003441NAC domain
PROSITE profilePS5100520.479684IPR003441NAC domain
PfamPF023651.9E-9749IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKVNG RTIELEIIPE VDLYKCEPWD LPGRFELPPV  60
SSRTDGVADI PVNGVEGRVC RGET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-172541163Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104136.15e-33PREDICTED: NAC transcription factor 29-like
SwissprotQ9FFI53e-31NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM4CGK27e-33M4CGK2_BRARP; Uncharacterized protein
STRINGBra003335.1-P2e-32(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-34NAC domain containing protein 20